PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038584.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 401aa    MW: 45925.9 Da    PI: 5.9089
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038584.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.48.2e-51161441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv+ ++++l +vi+evd++k+ePwd+++++k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  Pbr038584.1  16 VPPGFRFHPTEEELLHYYLRKKVAFERIDL-DVIREVDLNKLEPWDIQERCKIgstPQNDWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKIIYS- 111
                  69****************************.9***************964444222455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Pbr038584.1 112 GFKRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                  9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5710175IPR003441NAC domain
PROSITE profilePS5100556.34416175IPR003441NAC domain
PfamPF023651.5E-2617144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSDDQMSLSI NGQSQVPPGF RFHPTEEELL HYYLRKKVAF ERIDLDVIRE VDLNKLEPWD  60
IQERCKIGST PQNDWYFFSH KDKKYPTGTR TNRATTAGFW KATGRDKIIY SGFKRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDESNTH ETTVSSSMGE SMTEDGWVVC RVFKKKNYQK  180
ALESPKASFS MDSSNNQMNG SRNDGVLDQI LMYMGRTTCK LENHDQSLTM NNISERFMHL  240
PRLESPTLPN LPAFDQERSF KACYSAIDDM FIETEPSSTN QPSNGCDNND LVDDHEYPKT  300
RLNDWATLDR LVASQLGQLN GQDPETPKHL SCFGDPNMAF CSSPHPNDQD NDVQLSYPYL  360
RTSRSSDHQS EVYNNENDLW NFTKSSSSPS SSDPLCHLSV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-501617715170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360199.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-115NAC43_ARATH; NAC domain-containing protein 43
TrEMBLD9ZJA50.0D9ZJA5_MALDO; NAC domain class transcription factor
STRINGPOPTR_0011s15640.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-106NAC family protein